Novus Biologicals
Manufacturer Code:NBP183098
Catalog # NBP183098
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Calcium-independent phospholipase A2-gamma; calcium-independent phospholipase A2-gamma EC 3.1.1.5 Intracellular membrane-associated calcium-independent phospholipase A2 gamma iPLA2 gamma IPLA22 IPLA2-2 iPLA2-gamma IPLA2GIPLA2(GAMMA) membrane-associated calcium-independent phospholipase A2 gamma patatin-like phospholipase domain containing 8 Patatin-like phospholipase domain-containing protein 8 PNPLA-gamma; Intracellular membrane-associated calcium-independent phospholipase A2 gamma; iPLA2-2; iPLA2-gamma; membrane-associated calcium-independent phospholipase A2 gamma; patatin-like phospholipase domain containing 8; Patatin-like phospholipase domain-containing protein 8; PNPLA-gamma
Gene Aliases: BM-043; IPLA2-2; IPLA22; IPLA2G; iPLA2gamma; MMLA; PNPLA-gamma; PNPLA8
UniProt ID: (Human) Q9NP80
Entrez Gene ID: (Human) 50640
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.