Novus Biologicals
Manufacturer Code:NBP188347
Catalog # NBP188347
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: brain protein 17; BRP17FKSG19 DKFZp564N1362 DYT8paroxysmal nonkinesiogenic dyskinesia FPD1brain protein 17 KIAA1184Myofibrillogenesis regulator 1 KIPP1184probable hydrolase PNKD MGC31943 MR1Paroxysmal nonkinesiogenic dyskinesia protein MR-1Trans-activated by hepatitis C virus core protein 2 paroxysmal nonkinesigenic dyskinesia PDCEC 3.- TAHCCP2PKND1; MR-1; Myofibrillogenesis regulator 1; Paroxysmal nonkinesiogenic dyskinesia protein; Probable hydrolase PNKD; Trans-activated by hepatitis C virus core protein 2
Gene Aliases: BRP17; DYT8; FKSG19; FPD1; KIAA1184; KIPP1184; MR-1; MR1; PDC; PKND1; PNKD; TAHCCP2; UNQ2491/PRO5778
UniProt ID: (Human) Q8N490
Entrez Gene ID: (Human) 25953
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.