Novus Biologicals
Manufacturer Code:NBP238199
Catalog # NBP238199
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 70 kDa peroxisomal membrane protein; 70 kDa peroxisomal membrane protein ABC43 ATP-binding cassette sub-family D (ALD) member 3 peroxisomal membrane protein 1 (70kD Zellweger syndrome) Peroxisomal membrane protein-1 (70kD) PMP70ATP-binding cassette sub-family D member 3 PXMP1dJ824O18.1 (ATP-binding cassette sub-family D (ALD) member 3 (PMP70 PXMP1)) ZWS2; ATP-binding cassette sub-family D member 3; ATP-binding cassette, sub-family D (ALD), member 3; dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)); peroxisomal membrane protein 1 (70kD, Zellweger syndrome); Peroxisomal membrane protein-1 (70kD); PMP70
Gene Aliases: ABC43; ABCD3; CBAS5; PMP70; PXMP1; ZWS2
UniProt ID: (Human) P28288
Entrez Gene ID: (Human) 5825
Molecular Function: transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.