Novus Biologicals
Manufacturer Code:NBP257753
Catalog # NBP257753
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDG1 CDG1A CDGS EC 5.4.2.8 phosphomannomutase 2 PMM 2; mannose-6-phosphate isomerase; Phosphomannomutase 2; phosphomannose isomerase 1; PMM 2
Gene Aliases: CDG1; CDG1a; CDGS; PMI; PMI1; PMM 2; PMM2
UniProt ID: (Human) O15305
Entrez Gene ID: (Human) 5373
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.