Novus Biologicals
Manufacturer Code:NBP159481
Catalog # NBP159481
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ATP2B4(ATPase Ca++ transporting plasma membrane 4) The peptide sequence was selected from the middle region of ATP2B4. Peptide sequence FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP2B2plasma membrane calcium ATPase ATPase Ca++ transporting plasma membrane 4 DKFZp686G08106 DKFZp686M088 EC 3.6.3 EC 3.6.3.8 Matrix-remodeling-associated protein 1 matrix-remodelling associated 1 MXRA1 Plasma membrane calcium ATPase isoform 4 plasma membrane calcium pump Plasma membrane calcium pump isoform 4 plasma membrane calcium-transporting ATPase 4 PMCA4b PMCA4PMCA4x sarcolemmal calcium pump; ATPase, Ca++ transporting, plasma membrane 4; Matrix-remodeling-associated protein 1; Plasma membrane calcium ATPase isoform 4; Plasma membrane calcium pump isoform 4; Plasma membrane calcium-transporting ATPase 4; PMCA4; sarcolemmal calcium pump
Gene Aliases: ATP2B2; ATP2B4; MXRA1; PMCA4; PMCA4b; PMCA4x
UniProt ID: (Human) P23634
Entrez Gene ID: (Human) 493
Molecular Function:
cation transporter
hydrolase
ion channel
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.