Novus Biologicals
Manufacturer Code:NBP232018
Catalog # NBP232018
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FAPP-1; FAPP-1 FAPP1PH domain-containing family A member 3 FLJ20067 four-phosphate-adaptor protein 1 Phosphatidylinositol-four-phosphate adapter protein 1 Phosphoinositol 4-phosphate adapter protein 1 pleckstrin homology domain containing family A (phosphoinositide bindingspecific) member 3 pleckstrin homology domain-containing family A member 3 pleckstrin homology domain-containing family A (phosphoinositide bindingspecific) member 3; four-phosphate-adaptor protein 1; PH domain-containing family A member 3; Phosphatidylinositol-four-phosphate adapter protein 1; phosphoinositol 4-phosphate adapter protein 1; pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3; Pleckstrin homology domain-containing family A member 3; pleckstrin homology domain-containing, family A (phosphoinositide binding specific) member 3
Gene Aliases: FAPP1; PLEKHA3
UniProt ID: (Human) Q9HB20
Entrez Gene ID: (Human) 65977
Molecular Function:
nucleic acid binding
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.