Novus Biologicals
Manufacturer Code:NBP158257
Catalog # NBP158257
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PLCB1(phospholipase C beta 1 (phosphoinositide-specific)) The peptide sequence was selected from the middle region of PLCB1. Peptide sequence EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate; 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1; EC 3.1.4.11 EIEE12 FLJ45792 inositoltrisphosphohydrolase KIAA05811-phosphatidylinositol-45-bisphosphate phosphodiesterase beta 1 monophosphatidylinositol phosphodiesterase phosphoinositidase C Phosphoinositide phospholipase C-beta-1 phospholipase C beta 1 (phosphoinositide-specific) Phospholipase C-beta-1 Phospholipase C-I PI-PLC PLC-154 PLC1541-phosphatidylinositol-45-bisphosphate phosphodiesterase beta-1 PLCB1A PLCB1B PLC-beta-1 PLC-I1-phosphatidyl-D-myo-inositol-45-bisphosphate triphosphoinositide phosphodiesterase; inositoltrisphosphohydrolase; monophosphatidylinositol phosphodiesterase; phosphoinositidase C; Phosphoinositide phospholipase C-beta-1; phospholipase C, beta 1 (phosphoinositide-specific); Phospholipase C-beta-1; Phospholipase C-I; PLC-154; PLC-beta-1; PLC-I; triphosphoinositide phosphodiesterase
Gene Aliases: EIEE12; KIAA0581; PI-PLC; PLC-154; PLC-beta-1; PLC-I; PLC154; PLCB1; PLCB1A; PLCB1B
UniProt ID: (Human) Q9NQ66
Entrez Gene ID: (Human) 23236
Molecular Function:
G-protein modulator
calcium-binding protein
enzyme modulator
guanyl-nucleotide exchange factor
hydrolase
lipase
phospholipase
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.