Novus Biologicals
Manufacturer Code:NBP2854850.1ML
Catalog # NB033414
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. Aliquot and store at -20°:C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: down-regulated in gastrointestinal cancer protein; placenta-specific 8; Placenta-specific gene 8 protein; Protein C15
Gene Aliases: BM-004; C15; DGIC; onzin; PLAC8; PNAS-144
UniProt ID: (Human) Q9NZF1
Entrez Gene ID: (Human) 51316
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.