Novus Biologicals
Manufacturer Code:NBP18011220UL
Catalog # NB8011220UL
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human PLA2G4B. Peptide sequence: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cPLA2-beta; Cytosolic phospholipase A2 beta; FLJ20543 FLJ20656 FLJ20807 FLJ77014 FLJ78330 jmjC domain-containing protein 7 jumonji domain containing 7 Jumonji domain-containing protein 7; jumonji domain containing 7-phospholipase A2, group IVB (cytosolic) read-through; Lysophospholipase A1 group IVB; Phospholipase A2 group IVB
Gene Aliases: cPLA2-beta; HsT16992; PLA2G4B
UniProt ID: (Human) P0C869
Entrez Gene ID: (Human) 8681
Molecular Function:
hydrolase
lipase
phospholipase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.