Novus Biologicals
Manufacturer Code:NBP238718
Catalog # NBP238718
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: calcium-dependent phospholipid-binding protein; calcium-dependent phospholipid-binding protein cPLA2 cPLA2-alpha lysophospholipase MGC126350 phosphatidylcholine 2-acylhydrolase Phospholipase A2 group IVA phospholipase A2 group IVA (cytosolic calcium-dependent) PLA2G4cytosolic phospholipase A2; cPLA2; Cytosolic phospholipase A2; Lysophospholipase; Phosphatidylcholine 2-acylhydrolase; Phospholipase A2; Phospholipase A2 group IVA; phospholipase A2, group IVA (cytosolic, calcium-dependent)
Gene Aliases: CPLA2; cPLA2-alpha; PLA2G4; PLA2G4A
UniProt ID: (Human) P47712
Entrez Gene ID: (Human) 5321
Molecular Function: hydrolase lipase phospholipase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.