Novus Biologicals
Manufacturer Code:NBP158916
Catalog # NBP158916
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
ChIP assay (ChIP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PRKCG(protein kinase C gamma) The peptide sequence was selected from the N terminal of PRKCG. Peptide sequence FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.11 EC 2.7.11.13 MGC57564 PKCCSCA14 PKC-gamma PKCGprotein kinase C gamma type protein kinase C gamma; PKC-gamma; Protein kinase C gamma type; protein kinase C, gamma
Gene Aliases: PKC-gamma; PKCC; PKCG; PRKCG; SCA14
UniProt ID: (Human) P05129
Entrez Gene ID: (Human) 5582
Molecular Function: annexin calcium-binding protein calmodulin intracellular calcium-sensing protein kinase non-receptor serine/threonine protein kinase protein kinase transfer/carrier protein transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.