Novus Biologicals
Manufacturer Code:NBP182383
Catalog # NBP182383
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide towards Pitx1. Peptide sequence LCKGGYVPQFSGLVQPYEDVYAAAGYSYNNWAAKSLAPAPLSTKSFTFFN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BFTpituitary homeobox 1 CCF Hindlimb-expressed homeobox protein backfoot Homeobox protein PITX1 paired-like homeodomain 1 pituitary otx-related factor POTXpituitary homeo box 1 PTX1Paired-like homeodomain transcription factor 1hindlimb expressed homeobox protein backfoot; hindlimb expressed homeobox protein backfoot; Hindlimb-expressed homeobox protein backfoot; Homeobox protein PITX1; paired-like homeodomain 1; Paired-like homeodomain transcription factor 1; pituitary homeo box 1; Pituitary homeobox 1; pituitary otx-related factor
Gene Aliases: BFT; CCF; LBNBG; PITX1; POTX; PTX1
UniProt ID: (Human) P78337
Entrez Gene ID: (Human) 5307
Molecular Function:
DNA binding protein
helix-turn-helix transcription factor
homeobox transcription factor
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.