Novus Biologicals
Manufacturer Code:NBP198374
Catalog # NBP198374
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is PITPN - C-terminal region. Peptide sequence FTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: epididymis secretory protein Li 36; MGC99649 phosphatidylinositol transfer protein alpha isoform phosphatidylinositol transfer protein alpha PI-TPalpha PI-TP-alpha PITPNphosphotidylinositol transfer protein PtdIns transfer protein alpha PtdInsTP alpha VIB1A; Phosphatidylinositol transfer protein alpha isoform; phosphatidylinositol transfer protein, alpha; PI-TP-alpha; ptdIns transfer protein alpha; ptdInsTP alpha
Gene Aliases: HEL-S-36; PI-TPalpha; PITPN; PITPNA; VIB1A
UniProt ID: (Human) Q00169
Entrez Gene ID: (Human) 5306
Molecular Function:
transfer/carrier protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.