Novus Biologicals
Manufacturer Code:NBP152994
Catalog # NBP152994
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PIN4(protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 4 (parvulin)) The peptide sequence was selected from the N terminal of PIN4. Peptide sequence MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4 (parvulin) MGC138486 Parvulin-17 protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 4 (parvulin); eukaryotic parvulin homolog; hEPVH; hPar14; hPar17; Par14; Par17; parvulin; Parvulin-14; Parvulin-17; Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; Peptidyl-prolyl cis-trans isomerase Pin4; Peptidyl-prolyl cis/trans isomerase EPVH; peptidylprolyl cis/trans isomerase NIMA-interacting, 4; PPIase PIN4; protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin); Rotamase Pin4
Gene Aliases: EPVH; PAR14; PAR17; PIN4
UniProt ID: (Human) Q9Y237
Entrez Gene ID: (Human) 5303
Molecular Function: isomerase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.