Novus Biologicals
Manufacturer Code:NBP255816
Catalog # NBP255816
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.11.1 pim-3 pim-3 oncogene serine/threonine kinase Pim-3 serine/threonine-protein kinase pim-3; pim-3 oncogene; serine/threonine kinase Pim-3; Serine/threonine-protein kinase pim-3
Gene Aliases: pim-3; PIM3
UniProt ID: (Human) Q86V86
Entrez Gene ID: (Human) 415116
Molecular Function:
kinase
protein kinase
protein kinase receptor
receptor
serine/threonine protein kinase receptor
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.