Novus Biologicals
Manufacturer Code:NBP232502
Catalog # NBP232502
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: APVEVVDMGGTEDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKNETLLFPHLTLEDPPALSSL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: class Z EC 2.4.1 EC 2.4.1.- FLJ12768 GPI mannosyltransferase 4 GPI mannosyltransferase IV GPI-MT-IV hSMP3 phosphatidylinositol glycan anchor biosynthesis class Z Phosphatidylinositol-glycan biosynthesis class Z protein PIG-Z SMP3 mannosyltransferase SMP3SMP3 homolog; dol-P-Man dependent GPI mannosyltransferase; GPI mannosyltransferase 4; GPI mannosyltransferase IV; GPI-MT-IV; hSMP3; phosphatidylinositol glycan anchor biosynthesis, class Z; phosphatidylinositol glycan, class Z; Phosphatidylinositol-glycan biosynthesis class Z protein; PIG-Z; SMP3 homolog; SMP3 mannosyltransferase
Gene Aliases: GPI-MT-IV; PIG-Z; PIGZ; SMP3
UniProt ID: (Human) Q86VD9
Entrez Gene ID: (Human) 80235
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.