Novus Biologicals
Manufacturer Code:NBP169251
Catalog # NBP169251
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PIGZ(phosphatidylinositol glycan anchor biosynthesis class Z) The peptide sequence was selected from the N terminal of PIGZ. Peptide sequence VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: class Z EC 2.4.1 EC 2.4.1.- FLJ12768 GPI mannosyltransferase 4 GPI mannosyltransferase IV GPI-MT-IV hSMP3 phosphatidylinositol glycan anchor biosynthesis class Z Phosphatidylinositol-glycan biosynthesis class Z protein PIG-Z SMP3 mannosyltransferase SMP3SMP3 homolog; dol-P-Man dependent GPI mannosyltransferase; GPI mannosyltransferase 4; GPI mannosyltransferase IV; GPI-MT-IV; hSMP3; phosphatidylinositol glycan anchor biosynthesis, class Z; phosphatidylinositol glycan, class Z; Phosphatidylinositol-glycan biosynthesis class Z protein; PIG-Z; SMP3 homolog; SMP3 mannosyltransferase
Gene Aliases: GPI-MT-IV; PIG-Z; PIGZ; SMP3
UniProt ID: (Human) Q86VD9
Entrez Gene ID: (Human) 80235
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.