Novus Biologicals
Manufacturer Code:NBP162449
Catalog # NBP162449
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PIGV(phosphatidylinositol glycan anchor biosynthesis class V) The peptide sequence was selected from the N terminal of PIGV. Peptide sequence FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dol-P-Man dependent GPI mannosyltransferase; EC 2.4.1.- FLJ20477 GPI mannosyltransferase 2 GPI mannosyltransferase II GPI-MT-II phosphatidylinositol glycan anchor biosynthesis class V phosphatidylinositol glycan class V Phosphatidylinositol-glycan biosynthesis class V protein PIG-V Ybr004c homolog; GPI mannosyltransferase 2; GPI mannosyltransferase II; GPI-MT-II; phosphatidylinositol glycan anchor biosynthesis, class V; Phosphatidylinositol-glycan biosynthesis class V protein; PIG-V; Ybr004c homolog
Gene Aliases: GPI-MT-II; HPMRS1; PIG-V; PIGV
UniProt ID: (Human) Q9NUD9
Entrez Gene ID: (Human) 55650
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.