Novus Biologicals
Manufacturer Code:NBP15973820UL
Catalog # NBP15973820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PIGQ(phosphatidylinositol glycan anchor biosynthesis class Q) The peptide sequence was selected from the N terminal of PIGQ. Peptide sequence VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component)); c407A10.1 c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component)) class Q EC 2.4.1.198 hGPI1 MGC12693 N-acetylglucosaminyl transferase component Gpi1 N-acetylglucosamyl transferase component GPI1 phosphatidylinositol glycan anchor biosynthesis class Q phosphatidylinositol N-acetylglucosaminyltransferase subunit Q Phosphatidylinositol-glycan biosynthesis class Q protein PIG-Q; N-acetylglucosaminyl transferase component Gpi1; N-acetylglucosamyl transferase component GPI1; phosphatidylinositol glycan anchor biosynthesis, class Q; phosphatidylinositol glycan, class Q; Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q; Phosphatidylinositol-glycan biosynthesis class Q protein; PIG-Q
Gene Aliases: c407A10.1; GPI1; PIGQ
UniProt ID: (Human) Q9BRB3
Entrez Gene ID: (Human) 9091
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.