Novus Biologicals
Manufacturer Code:NBP16244620UL
Catalog # NBP16244620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PIGO(phosphatidylinositol glycan anchor biosynthesis class O) The peptide sequence was selected from the N terminal of PIGO. Peptide sequence LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: class O DKFZp434M222 EC 2.- FLJ00135 GPI ethanolamine phosphate transferase 3 MGC20536 MGC3079 phosphatidylinositol glycan anchor biosynthesis class O Phosphatidylinositol-glycan biosynthesis class O protein PIG-O RP11-182N22.4; GPI ethanolamine phosphate transferase 3; phosphatidylinositol glycan anchor biosynthesis, class O; Phosphatidylinositol-glycan biosynthesis class O protein; PIG-O
Gene Aliases: HPMRS2; PIGO; UNQ632/PRO1249
UniProt ID: (Human) Q8TEQ8
Entrez Gene ID: (Human) 84720
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.