Novus Biologicals
Manufacturer Code:NBP181248
Catalog # NBP181248
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KVDDGVKEIVSMFNHFYGNDGKTTFIFTSDHGMTDWGSHGAGHPSETLTPLVTWGAGIKYPQRVSAQQFDDAFLKEWRLENWK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.- GPI ethanolamine phosphate transferase 1 MCD4 MCD4 homolog MDC4 MGC26427 phosphatidylinositol glycan anchor biosynthesis class N Phosphatidylinositol-glycan biosynthesis class N protein PIG-Nphosphatidylinositol glycan class N; GPI ethanolamine phosphate transferase 1; MCD4 homolog; phosphatidylinositol glycan anchor biosynthesis, class N; Phosphatidylinositol-glycan biosynthesis class N protein; PIG-N
Gene Aliases: MCAHS; MCAHS1; MCD4; MDC4; PIG-N; PIGN
UniProt ID: (Human) O95427
Entrez Gene ID: (Human) 23556
Molecular Function:
extracellular matrix glycoprotein
extracellular matrix protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.