Novus Biologicals
Manufacturer Code:NBP213761
Catalog # NBP213761
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dol-P-Man dependent GPI mannosyltransferase; DPM:GlcN-(acyl-)PI mannosyltransferase; EC 2.4.1 EC 2.4.1.- GPI mannosyltransferase 1 GPI mannosyltransferase I GPI-MT-IPIG-M mannosyltransferase MGC29896 phosphatidylinositol glycan anchor biosynthesis class M phosphatidylinositol glycan class M Phosphatidylinositol-glycan biosynthesis class M protein PIG-M; GPI mannosyltransferase 1; GPI mannosyltransferase I; GPI-MT-I; phosphatidylinositol glycan anchor biosynthesis, class M; Phosphatidylinositol-glycan biosynthesis class M protein; PIG-M; PIG-M mannosyltransferase
Gene Aliases: GPI-MT-I; PIGM
UniProt ID: (Human) Q9H3S5
Entrez Gene ID: (Human) 93183
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.