Novus Biologicals
Manufacturer Code:NBP169261
Catalog # NBP169261
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PIGF(phosphatidylinositol glycan anchor biosynthesis class F) The peptide sequence was selected from the N terminal of PIGF. Peptide sequence MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GPI11 homolog; GPI11 homolog MGC32646 MGC33136 phosphatidylinositol glycan anchor biosynthesis class F phosphatidylinositol glycan class F phosphatidylinositol-glycan biosynthesis class F protein PIG-F; phosphatidylinositol glycan anchor biosynthesis, class F; Phosphatidylinositol-glycan biosynthesis class F protein; PIG-F
Gene Aliases: PIGF
UniProt ID: (Human) Q07326
Entrez Gene ID: (Human) 5281
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.