Novus Biologicals
Manufacturer Code:NBP185856
Catalog # NBP185856
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEAD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dol-P-Man dependent GPI mannosyltransferase; EC 2.4.1 EC 2.4.1.- GPI mannosyltransferase 3 GPI mannosyltransferase III GPI-MT-III MGC21236 phosphatidylinositol glycan anchor biosynthesis class B phosphatidylinositol glycan class B Phosphatidylinositol-glycan biosynthesis class B protein PIG-B; GPI mannosyltransferase 3; GPI mannosyltransferase III; GPI-MT-III; phosphatidylinositol glycan anchor biosynthesis, class B; phosphatidylinositol glycan, class B; Phosphatidylinositol-glycan biosynthesis class B protein; PIG-B
Gene Aliases: GPI-MT-III; PIG-B; PIGB
UniProt ID: (Human) Q92521
Entrez Gene ID: (Human) 9488
Molecular Function: glycosyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.