Novus Biologicals
Manufacturer Code:NBP15970120UL
Catalog # NBP1597020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PIGA(phosphatidylinositol glycan anchor biosynthesis class A) The peptide sequence was selected from the middle region of PIGA. Peptide sequence SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: class A GlcNAc-inositol phospholipid assembly protein; class A GlcNAc-inositol phospholipid assembly protein EC 2.4.1.198 GlcNAc-PI synthesis protein GPI anchor biosynthesis GPI3 phosphatidylinositol glycan anchor biosynthesis class A phosphatidylinositol glycan class A (paroxysmal nocturnal hemoglobinuria) phosphatidylinositol N-acetylglucosaminyltransferase subunit A Phosphatidylinositol-glycan biosynthesis class A protein phosphatidylinositol-glycan biosynthesis class A protein PIG-A; GLCNAC-PI synthesis protein; GPI anchor biosynthesis; phosphatidylinositol glycan anchor biosynthesis, class A; Phosphatidylinositol N-acetylglucosaminyltransferase subunit A; Phosphatidylinositol-glycan biosynthesis class A protein; phosphatidylinositol-glycan biosynthesis, class A protein; PIG-A
Gene Aliases: GPI3; MCAHS2; PIG-A; PIGA; PNH1
UniProt ID: (Human) P37287
Entrez Gene ID: (Human) 5277
Molecular Function:
carbohydrate phosphatase
glycosyltransferase
hydrolase
nucleotidyltransferase
phosphatase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.