Novus Biologicals
Manufacturer Code:NBP256805
Catalog # NBP256805
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QELMKQEMETILLRQKQLEETNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAEELSTNK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C13orf24 chromosome 13 open reading frame 24 KIAA1008 PIBF progesterone immunomodulatory binding factor 1 progesterone-induced blocking factor 1 progesterone-induced-blocking factor 1 RP11-505F3.1; Centrosomal protein of 90 kDa; CEP90; PIBF; progesterone-induced blocking factor 1; Progesterone-induced-blocking factor 1
Gene Aliases: C13orf24; CEP90; PIBF; PIBF1
UniProt ID: (Human) Q8WXW3
Entrez Gene ID: (Human) 10464
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.