Novus Biologicals
Manufacturer Code:NBP154866
Catalog # NBP154866
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PHKG2 (phosphorylase kinase gamma 2 (testis)) The peptide sequence was selected from the N terminal of PHKG2. Peptide sequence EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.11 EC 2.7.11.19 GSD9C PHK-gamma-T phosphorylase b kinase gamma catalytic chain testis/liver isoform Phosphorylase kinase subunit gamma-2 phosphorylase kinase gamma 2 (testis) Phosphorylase kinase gamma 2 (testis/liver) PSK-C3; PHK-gamma-LT; PHK-gamma-T; Phosphorylase b kinase gamma catalytic chain, liver/testis isoform; phosphorylase b kinase gamma catalytic chain, testis/liver isoform; phosphorylase kinase gamma subunit 2; Phosphorylase kinase subunit gamma-2; phosphorylase kinase, gamma 2 (testis); Phosphorylase kinase, gamma 2 (testis/liver); PSK-C3; serine/threonine-protein kinase PHKG2
Gene Aliases: GSD9C; PHKG2
UniProt ID: (Human) P15735
Entrez Gene ID: (Human) 5261
Molecular Function: non-receptor serine/threonine protein kinase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.