Novus Biologicals
Manufacturer Code:NBP179637
Catalog # NBP179637
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human Phkg1The immunogen for this antibody is Phkg1. Peptide sequence REATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.11 EC 2.7.11.19 PHKG phosphorylase b kinase gamma catalytic chain skeletal muscle isoform phosphorylase kinase gamma Phosphorylase kinase subunit gamma-1 phosphorylase kinase gamma 1 (muscle); PHK-gamma-M; phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform; Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform; phosphorylase kinase gamma; phosphorylase kinase gamma subunit 1; Phosphorylase kinase subunit gamma-1; phosphorylase kinase, gamma 1 (muscle); Serine/threonine-protein kinase PHKG1
Gene Aliases: PHKG; PHKG1
UniProt ID: (Human) Q16816
Entrez Gene ID: (Human) 5260
Molecular Function:
non-receptor serine/threonine protein kinase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.