Novus Biologicals
Manufacturer Code:NBP152834
Catalog # NBP152834
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PGS1(phosphatidylglycerophosphate synthase 1) The peptide sequence was selected from the C terminal of PGS1. Peptide sequence RVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase DKFZP762M186 EC 2.7.8.5 MGC131960 mitochondrial PGP synthase 1 phosphatidylglycerophosphate synthase 1DKFZp762M186; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial; PGP synthase 1; Phosphatidylglycerophosphate synthase 1
Gene Aliases: PGS1
UniProt ID: (Human) Q32NB8
Entrez Gene ID: (Human) 9489
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.