Novus Biologicals
Manufacturer Code:NBP258518
Catalog # NBP258518
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 5-oxoprolyl-peptidase; EC 3.4.19.3 Pcp PGPIFLJ20208 PGP-IPAP-I PGPMGC10812 Pyroglutamyl aminopeptidase I pyroglutamyl-peptidase 1 pyroglutamyl-peptidase I5-oxoprolyl-peptidase Pyrrolidone-carboxylate peptidase; PAP-I; pGlu-peptidase I; PGP-I; Pyroglutamyl aminopeptidase I; Pyroglutamyl-peptidase 1; Pyroglutamyl-peptidase I; Pyrrolidone-carboxylate peptidase
Gene Aliases: PAP-I; Pcp; PGI; PGP; PGP-I; PGPEP1; PGPI
UniProt ID: (Human) Q9NXJ5
Entrez Gene ID: (Human) 54858
Molecular Function: cysteine protease hydrolase protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.