Novus Biologicals
Manufacturer Code:NBP231656
Catalog # NBP231656
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDVTTGYD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BM32Aglucose-16-bisphosphate synthase EC 2.7.1 EC 2.7.1.106 FLJ32029 glucose 16-bisphosphate synthase phosphoglucomutase 2-like 1 Phosphoglucomutase-2-like 1 PMMLP; Glucose 1,6-bisphosphate synthase; phosphoglucomutase 2-like 1; Phosphoglucomutase-2-like 1; PMMLP
Gene Aliases: BM32A; PGM2L1; PMMLP
UniProt ID: (Human) Q6PCE3
Entrez Gene ID: (Human) 283209
Molecular Function: glycosyltransferase isomerase mutase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.