Novus Biologicals
Manufacturer Code:NBP156528
Catalog # NBP156528
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PGM1(phosphoglucomutase 1) The peptide sequence was selected from the middle region of PGM1 (NP_002624). Peptide sequence ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 5.4.2 EC 5.4.2.2 Glucose phosphomutase 1 GSD14 PGM 1 phosphoglucomutase 1 phosphoglucomutase-1; Glucose phosphomutase 1; PGM 1; Phosphoglucomutase-1
Gene Aliases: CDG1T; GSD14; PGM1
UniProt ID: (Human) P36871
Entrez Gene ID: (Human) 5236
Molecular Function: glycosyltransferase isomerase mutase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.