Novus Biologicals
Manufacturer Code:NBP231930
Catalog # NBP231930
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.5.1.28 peptidoglycan recognition protein 2tagl-beta peptidoglycan recognition protein L PGLYRPLHMFT0141 PGRP-LN-acetylmuramoyl-L-alanine amidase PGRPLPeptidoglycan recognition protein long tagL tagL-alpha TAGL-like; N-acetylmuramoyl-L-alanine amidase; Peptidoglycan recognition protein 2; peptidoglycan recognition protein L; Peptidoglycan recognition protein long; PGRP-L
Gene Aliases: HMFT0141; PGLYRP2; PGLYRPL; PGRP-L; PGRPL; tagL; tagL-alpha; tagl-beta; TAGL-like; UNQ3103/PRO10102
UniProt ID: (Human) Q96PD5
Entrez Gene ID: (Human) 114770
Molecular Function: defense/immunity protein signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.