Novus Biologicals
Manufacturer Code:NBP192260
Catalog # NBP192260
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLYESRKRGMLENCILL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C11orf79 FLJ20487 hSDH5 paraganglioma or familial glomus tumors 2 PGL2chromosome 11 open reading frame 79 SDH5SDH assembly factor 2 succinate dehydrogenase assembly factor 2 mitochondrial succinate dehydrogenase complex assembly factor 2 Succinate dehydrogenase subunit 5 mitochondrial; hSDH5; SDH assembly factor 2; SDHAF2; Succinate dehydrogenase assembly factor 2, mitochondrial; succinate dehydrogenase subunit 5, mitochondrial
Gene Aliases: C11orf79; PGL2; SDH5; SDHAF2
UniProt ID: (Human) Q9NX18
Entrez Gene ID: (Human) 54949
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.