Novus Biologicals
Manufacturer Code:NBP198575
Catalog # NBP198575
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Pfkfb4 - middle region. Peptide sequence RIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 6-phosphofructo-2-kinase; 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4; 6-phosphofructo-2-kinase/fructose-26-biphosphatase 46-phosphofructo-2-kinase/fructose-26-biphosphatase-46PF-2-K/Fru-26-P2ase 46PF-2-K/Fru-26-P2ase testis-type isozyme bifunctional enzyme with kinase and biphosphatase activities PFK/FBPase 4; 6PF-2-K/Fru-2,6-P2ase 4; 6PF-2-K/Fru-2,6-P2ase testis-type isozyme; bifunctional enzyme with kinase and biphosphatase activities; Fructose-2,6-bisphosphatase; PFK/FBPase 4
Gene Aliases: PFKFB4
UniProt ID: (Human) Q16877
Entrez Gene ID: (Human) 5210
Molecular Function:
carbohydrate phosphatase
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.