Novus Biologicals
Manufacturer Code:NBP233584
Catalog # NBP233584
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 6-phosphofructo-2-kinase; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; 6PF-2-K/Fru-2,6-P2ASE heart-type isozyme; 6PF-2-K/Fru-26-P2ase 2 6-phosphofructo-2-kinase/fructose-26-biphosphatase 2 6-phosphofructo-2-kinase/fructose-26-bisphosphatase 2 DKFZp781D2217 fructose-26-bisphosphatase cardiac isozyme MGC1383086PF-2-K/Fru-26-P2ase heart-type isozyme MGC138310 PFK/FBPase 2 PFK-2/FBPase-2 PFKFB cardiac; Fructose-2,6-bisphosphatase; fructose-2,6-bisphosphatase, cardiac isozyme; PFK/FBPase 2; PFKFB, cardiac
Gene Aliases: PFK-2/FBPase-2; PFKFB2
UniProt ID: (Human) O60825
Entrez Gene ID: (Human) 5208
Molecular Function:
carbohydrate phosphatase
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.