Novus Biologicals
Manufacturer Code:NBP152960
Catalog # NBP152960
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PEX3(peroxisomal biogenesis factor 3) The peptide sequence was selected from the N terminal of PEX3. Peptide sequence KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp686N14184 FLJ13531 Peroxin-3 Peroxisomal assembly protein PEX3 peroxisomal biogenesis factor 3 transformation-related protein 18 TRG18; Peroxin-3; Peroxisomal assembly protein PEX3; Peroxisomal biogenesis factor 3; transformation-related protein 18
Gene Aliases: PBD10A; PEX3; TRG18
UniProt ID: (Human) P56589
Entrez Gene ID: (Human) 8504
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.