Novus Biologicals
Manufacturer Code:NBP192255
Catalog # NBP192255
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 33 kDa housekeeping protein; D1S2223Ehousekeeping gene 33kD HK3333 kDa housekeeping protein Peroxin-19 peroxisomal biogenesis factor 19 Peroxisomal farnesylated proteinFLJ55296 PMP1 PMPI PXFperoxin-19 PXMP1; housekeeping gene, 33kD; Peroxin-19; Peroxisomal biogenesis factor 19; Peroxisomal farnesylated protein
Gene Aliases: D1S2223E; HK33; OK/SW-cl.22; PBD12A; PEX19; PMP1; PMPI; PXF; PXMP1
UniProt ID: (Human) P40855
Entrez Gene ID: (Human) 5824
Molecular Function: storage protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.