Novus Biologicals
Manufacturer Code:NBP213750
Catalog # NBP213750
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAY EIRLLMEQESSACSRRLKGSGGG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Peroxin-11B; peroxin-11B peroxisomal biogenesis factor 11 beta Peroxisomal biogenesis factor 11Bperoxisomal membrane protein 11B PEX11-beta Protein PEX11 homolog beta; Peroxisomal biogenesis factor 11B; Peroxisomal membrane protein 11B; PEX11-beta; Protein PEX11 homolog beta
Gene Aliases: PEX11-BETA; PEX11B; PEX14B
UniProt ID: (Human) O96011
Entrez Gene ID: (Human) 8799
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.