Novus Biologicals
Manufacturer Code:NBP159705
Catalog # NBP159705
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PEX11A(peroxisomal biogenesis factor 11A) The peptide sequence was selected from the middle region of PEX11A (NP_003838). Peptide sequence MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 28 kDa peroxisomal integral membrane protein; 28 kDa peroxisomal integral membrane protein hsPEX11p MGC119947 MGC138534 Peroxin-11A peroxisomal biogenesis factor 11 alpha Peroxisomal biogenesis factor 11Aperoxin-11A peroxisomal membrane protein 11A PEX11 PEX11-alpha PMP28 Protein PEX11 homolog alpha; HsPEX11p; Peroxin-11A; Peroxisomal biogenesis factor 11A; Peroxisomal membrane protein 11A; PEX11-alpha; PMP28; Protein PEX11 homolog alpha
Gene Aliases: hsPEX11p; PEX11; PEX11-ALPHA; PEX11A; PMP28
UniProt ID: (Human) O75192
Entrez Gene ID: (Human) 8800
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.