Novus Biologicals
Manufacturer Code:NBP180925
Catalog # NBP180925
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:WKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cytochrome c oxidase assembly factor PET112 homolog; cytochrome oxidase assembly factor PET112 homolog; Cytochrome oxidase assembly factor PET112 homolog EC 6.3.5 EC 6.3.5.- Glu-ADT subunit B mitochondrial PET112 (yeast homolog)-like PET112-like (yeast); Glu-AdT subunit B; Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial; glutamyl-tRNA(Gln) amidotransferase, subunit B; PET112 homolog
Gene Aliases: GATB; HSPC199; PET112; PET112L
UniProt ID: (Human) O75879
Entrez Gene ID: (Human) 5188
Molecular Function:
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.