Novus Biologicals
Manufacturer Code:NBP155286
Catalog # NBP155286
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PDZK1(PDZ domain containing 1) The peptide sequence was selected from the n terminal of PDZK1. Peptide sequence MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: CAP70 CFTR-associated protein of 70 kDa CLAMP Na(+)/H(+) exchanger regulatory factor 3 Na/Pi cotransporter C-terminal-associated protein 1 naPi-Cap1 NHERF-3 NHERF3PDZD1Na(+)/H(+) exchange regulatory cofactor NHE-RF3 PDZ domain containing 1 PDZ domain-containing protein 1 PDZ-containing kidney protein 1 Sodium-hydrogen exchanger regulatory factor 3; CFTR-associated protein of 70 kDa; Na(+)/H(+) exchange regulatory cofactor NHE-RF3; Na(+)/H(+) exchanger regulatory factor 3; Na/Pi cotransporter C-terminal-associated protein 1; NaPi-Cap1; NHERF-3; PDZ domain-containing protein 1; PDZ-containing kidney protein 1; Sodium-hydrogen exchanger regulatory factor 3
Gene Aliases: CAP70; CLAMP; NHERF-3; NHERF3; PDZD1; PDZK1
UniProt ID: (Human) Q5T2W1
Entrez Gene ID: (Human) 5174
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.