Novus Biologicals
Manufacturer Code:NBP182912
Catalog # NBP182912
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase; [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial; EC 3.1.3 EC 3.1.3.43 KIAA1348[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2 mitochondrial PDP 2 PDPC 2 PPM2C2 protein phosphatase 2C magnesium-dependent catalytic subunit 2 Pyruvate dehydrogenase phosphatase catalytic subunit 2 pyruvate dehydrogenase phosphatase isoenzyme 2 pyruvate dehydrogenase phosphatase catalytic subunit 2 pyruvate dehyrogenase phosphatase catalytic subunit 2; PDP 2; PDPC 2; protein phosphatase 2C, magnesium-dependent, catalytic subunit 2; protein phosphatase, Mg2+/Mn2+ dependent 2B; Pyruvate dehydrogenase phosphatase catalytic subunit 2; pyruvate dehydrogenase phosphatase isoenzyme 2; pyruvate dehydrogenase phosphatase, catalytic subunit 2
Gene Aliases: KIAA1348; PDP2; PPM2B; PPM2C2
UniProt ID: (Human) Q9P2J9
Entrez Gene ID: (Human) 57546
Molecular Function:
enzyme modulator
hydrolase
kinase inhibitor
kinase modulator
phosphatase
protein phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.