Novus Biologicals
Manufacturer Code:NBP184841
Catalog # NBP184841
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1110003B01Rik; 1110003B01Rik ENIGMAProtein enigma LIM domain protein LIM mineralization protein LMP LMP1 PDZ and LIM domain 7 (enigma) PDZ and LIM domain protein 7; LIM domain protein; LIM mineralization protein; Lim mineralization protein 3; LMP; PDZ and LIM domain 7 (enigma); PDZ and LIM domain protein 7; Protein enigma
Gene Aliases: ENIGMA; LMP1; LMP3; PDLIM7
UniProt ID: (Human) Q9NR12
Entrez Gene ID: (Human) 9260
Molecular Function: actin family cytoskeletal protein cytoskeletal protein transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.