Novus Biologicals
Manufacturer Code:NBP17953620UL
Catalog # NBP17953620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human PDHA2The immunogen for this antibody is PDHA2. Peptide sequence RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.2.4.1 MGC149517 MGC149518 mitochondrial PDHAL PDHE1-A type II pyruvate dehydrogenase (lipoamide) alpha 2 pyruvate dehydrogenase E1 component subunit alpha testis-specific form pyruvate dehydrogenase E1-alpha polypeptide testis specific; PDHE1-A type II; Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial; pyruvate dehydrogenase, E1-alpha polypeptide, testis specific
Gene Aliases: PDHA2; PDHAL
UniProt ID: (Human) P29803
Entrez Gene ID: (Human) 5161
Molecular Function:
dehydrogenase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.