Novus Biologicals
Manufacturer Code:NBP238087
Catalog # NBP238087
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: IEGFMSTP036 Iris-expressed growth factor PDGF-D platelet derived growth factor D SCDGF-BMGC26867 SCDGFBplatelet-derived growth factor D spinal cord derived growth factor B Spinal cord-derived growth factor B spinal cord-derived growth factor-B; Iris-expressed growth factor; PDGF-D; PDGFD latent form; PDGFD receptor-binding form; Platelet-derived growth factor D; Platelet-derived growth factor D, latent form; Platelet-derived growth factor D, receptor-binding form; SCDGF-B; spinal cord derived growth factor B; Spinal cord-derived growth factor B; spinal cord-derived growth factor-B
Gene Aliases: IEGF; MSTP036; PDGFD; SCDGF-B; SCDGFB; UNQ1899/PRO4345
UniProt ID: (Human) Q9GZP0
Entrez Gene ID: (Human) 80310
Molecular Function:
growth factor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.