Novus Biologicals
Manufacturer Code:NBP15295620UL
Catalog # NBP15295620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to PDE1C(phosphodiesterase 1C calmodulin-dependent 70kDa) The peptide sequence was selected from the middle region of PDE1C. Peptide sequence IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3',5'-cyclic-AMP phosphodiesterase; 3',5'-cyclic-GMP phosphodiesterase; Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C; calmodulin-dependent (70kD) EC 3.1.4 phosphodiesterase 1C calmodulin-dependent 70kDa; Cam-PDE 1C; Hcam3; Human 3',5' cyclic nucleotide phosphodiesterase (HSPDE1C1A); phosphodiesterase 1C, calmodulin-dependent 70kDa
Gene Aliases: cam-PDE 1C; hCam-3; Hcam3; PDE1C
UniProt ID: (Human) Q14123
Entrez Gene ID: (Human) 5137
Molecular Function:
hydrolase
phosphodiesterase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.