Novus Biologicals
Manufacturer Code:NBP186009
Catalog # NBP186009
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3'-5' cyclic nucleotide phosphodiesterase 61 kDa Cam-PDE calcium/calmodulin-dependent 3'-5'-cyclic nucleotide phosphodiesterase 1A calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase calmodulin-dependent phosphodiesterase Cam-PDE 1A EC 3.1.4 EC 3.1.4.17 hCam-1 HCAM1 HSPDE1A MGC26303 phosphodiesterase 1A calmodulin-dependent phosphodiesterase-1A; 61 kDa Cam-PDE; Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A; calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase; Cam-PDE 1A; hCam-1; phosphodiesterase 1A, calmodulin-dependent
Gene Aliases: CAM-PDE-1A; HCAM-1; HCAM1; HSPDE1A; PDE1A
UniProt ID: (Human) P54750
Entrez Gene ID: (Human) 5136
Molecular Function:
hydrolase
phosphodiesterase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.