Novus Biologicals
Manufacturer Code:NBP170672
Catalog # NBP170672
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to 2'-PDE The peptide sequence was selected from the middle region of 2'-PDE. Peptide sequence CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2',5'-phosphodiesterase 12; 2'-PDE; 2'-PDE phosphodiesterase 12; 2'-phosphodiesterase; Mitochondrial deadenylase
Gene Aliases: 2'-PDE; 2-PDE; PDE12
UniProt ID: (Human) Q6L8Q7
Entrez Gene ID: (Human) 201626
Molecular Function:
RNA binding protein
exoribonuclease
nuclease
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.