Novus Biologicals
Manufacturer Code:NBP185919
Catalog # NBP185919
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cAMP and cGMP cyclic nucleotide phosphodiesterase 11A; cAMP and cGMP cyclic nucleotide phosphodiesterase 11A cAMP and cGMP phosphodiesterase 11A cyclic nucleotide phosphodiesterase 11A dual 3'-5'-cyclic-AMP and -GMP phosphodiesterase 11A EC 3.1.4 EC 3.1.4.17 EC 3.1.4.35 FLJ23693 MGC133355 MGC133356 PDE11A1 PDE11A2 PDE11A3 phosphodiesterase 11A PPNAD2; cAMP and cGMP phosphodiesterase 11A; Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
Gene Aliases: PDE11A; PPNAD2
UniProt ID: (Human) Q9HCR9
Entrez Gene ID: (Human) 50940
Molecular Function:
hydrolase
phosphodiesterase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.